§
Luxuse
Patent Intelligence
Sign In
← Back to Patent Explorer
US4876242A Expired / Lapsed US ⏱️ 0.0 years remaining

Human insulin-like growth factor analoges with reduced binding to serum carrier proteins and their production in yeast

Assignee: Merck and Co Inc
•
Filing: 1987-09-21
•
Granted: 1989-10-24
•
Expires: 2007-09-21
📄 Original PDF 🌐 Google Patents 🔄 Sync Now

Abstract

Abstract A synthetic gene encoding a 71-amino acid analog of human insulin-like grouwth factor (hIGF-I) has been constructed and expressed in the yeast, Saccharomyces cerevisiae. The protein analog, IGF132, contains the first 17 amino acids of the B chain of human insulin in place of the first 16 amino acids of hIGF-I. The purified hybrid protein has high affinity for the type I IGF recepto (12 nM) yet has drastically reduced affinity for human serum carrier proteins (>1000 nM). This analog is 5 to 10 times more active than normal hIGF-I in stimulating DNA synthesis in 3T3 cells and is a more active growth factor in vivo due to its reduced affinity for serum carrier proteins. Other proteins with similar properties have also been constructed. The protein analogs thus have a variety of utilities such as in promoting lactation in animals; promoting growth and feed efficiency in animals; improving carcass quality by increasing lean and decreasing fat; promoting wound healing in animals, including humans; promoting glucose utilization in skeletal muscle, and stimulating erythropoiesis, the production of red blood cells.

Inventors

  • 👤 Joy D. Applebaum
  • 👤 Marvin L. Bayne
  • 👤 Margaret A. Cascieri

Bibliographic Details

Application Number —
Jurisdiction US
Data Source google_patents
Last Synchronized 2026-11-07 16:21
CPC Classifications
C; C07; C07K; C07K14/00; C07K14/435; C07K14/575; C07K14/65; A; A61; A61P; A61P15/00; A61P43/00; A61P7/00; A61P7/06; C07K14/62; A61K; A61K38/00; C07K2319/00

Claims Analysis

Total Claims: 14
Claim 1
Independent Claim 100 words
A synthetic polypeptide analog of hIGF-I which has the structure: A.sub.1 -A.sub.2 -A.sub.3 -A.sub.4 -LCG-A.sub.5 -A.sub.6 -LV-A.sub.7 AL-A.sub.8 -A.sub.9 -R.sub.1 wherein: A 1 is G, V, or FV; A 2 is P or N; A 3 is E or Q; A 4 is T, H or A; A 5 is A or S; A 6 is E or H; A 7 is D or E; A 8 is Q or Y; A 9 is F or L; and R 1 is VCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA provided that the A 1 to A 9 groups and R 1 do not constitute GPETLCGAELVDALQF-R 1 .
Claim 2
Dependent Claim 100 words
A synthetic polypeptide analog of hIGF-I which has the structure: A.sub.1 -A.sub.2 -A.sub.3 -A.sub.4 -LCG-A.sub.5 -A.sub.6 -LV-A.sub.7 AL-A.sub.8 -A.sub.9 -R.sub.1 wherein: A 1 is G, V, or FV; A 2 is P or N; A 3 is E or Q; A 4 is T, H or A; A 5 is A or S; A 6 is E or H; A 7 is D or E; A 8 is Q or Y; A 9 is F or L; and R 1 is VCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA provided that the A 1 to A 9 groups and R 1 do not constitute GPETLCGAELVDALQF-R 1 .
Claim 3
Dependent Claim 54 words
The peptide of claim 1 wherein: A 1 is G, V, or FV; A 2 is P or N; A 3 is Q; A 4 is A; A 5 is A or S; A 6 is E or H; A 7 is D or E; A 8 is Y; and A 9 is L.
Claim 4
Dependent Claim 10 words
The peptide of claim 1 which is: FVNQHLCGSHLVEALYL-R 1 .
Claim 5
Dependent Claim 10 words
The peptide of claim 1 which is: GPETLCGAELVDALYL-R 1 .
Claim 6
Dependent Claim 10 words
The peptide of claim 1 which is: GPQALCGAELVDALQF-R 1 .
Claim 7
Dependent Claim 10 words
The peptide of claim 1 which is: GPQALCGAELVDALYL-R 1 .
Claim 8
Dependent Claim 10 words
The peptide of claim 1 which is: VNQHLCGSHLVEALYL-R 1 .
Claim 9
Dependent Claim 51 words
A composition useful for the promotion of lactation, growth and feed efficiency, woulnd healing or stimulating erythropoiesis in animals, or increasing the lean and decreasing the fat content of meat producing animals which comprises an inert carrier and an effective amount of a synthetic polypeptide analog of hIGF-I of claim 1.
Claim 10
Dependent Claim 25 words
A method for the promotion of lactation in animals which comprises administering to a lactating animal a synthetic polypeptide analog of hIGF-I of claim 1.
Claim 11
Dependent Claim 25 words
A method for promoting growth and feed efficiency in animals which comprises administering to such animals a synthetic polypeptide analog of hIGF-I of claim 1.
Claim 12
Dependent Claim 30 words
A method for increasing the lean and decreasing the fat content of meat producing animals which comprises administering to such animals a synthetic polypeptide analog of hIGF-I of claim 1.
Claim 13
Dependent Claim 24 words
A method for promoting wound healing in animals which comprises administering to a wounded animal a synthetic polypeptide analog of hIGF-I of claim 1.
Claim 14
Dependent Claim 26 words
A method for stimulating erythropoiesis in animals which comprises administering to an animal in need of erythropoiesis a synthetic polypeptide analog of hIGF-I of claim 1.

References Cited (Backward Citations)

WO1987001038A1 Cited

USPTO Annuity & Maintenance Windows

Annuity Stage Window Opens Payment Deadline Surcharge Period Until Estimated Fee Status
3.5 Years (Year 4) 1992-10-23 1993-04-24 1993-10-24 $2000.00 Window Closed / Lapsed
7.5 Years (Year 8) 1996-10-23 1997-04-24 1997-10-24 $3760.00 Window Closed / Lapsed
11.5 Years (Year 12) 2000-10-23 2001-04-24 2001-10-24 $7700.00 Window Closed / Lapsed

Assigned Categories & Tags

No categories assigned to this patent yet.

Assign Category Tag