US4753883A
Expired / Lapsed
US
⏱️ 0.0 years remaining
Enzyme deregulation
Assignee: BTI AND OMNIGENE Inc
•
Filing: 1986-05-07
•
Granted: 1988-06-28
•
Expires: 2006-05-07
Abstract
Abstract Proteins having chorismate mutase-prephenate dehydratase (CMPD) activity, but lacking phenylalanine sensitivity are produced by genetic engineering. The proteins contain a sequence substantially corresponding to the N-terminal 337 amino acids of Escherichia coli CMPD. Expression vectors including genes coding for those proteins and regulatory DNA enabling their expression are used to transform host microorganisms, which are cultured to produce phenylalanine.
Inventors
- 👤 Keith C. Backman
- 👤 Ramaswamy Balakrishnan
Bibliographic Details
Application Number
—
Jurisdiction
US
Data Source
google_patents
Last Synchronized
2026-11-09 08:35
CPC Classifications
C; C12; C12P; C12P13/00; C12P13/04; C12P13/22; C12P13/222; C12N; C12N15/00; C12N15/09; C12N15/11; C12N15/52; C12N15/63; C12N15/70; C12N9/00; C12N9/88; C12N9/90; C07; C07K; C07K2319/00
Claims Analysis
Total Claims: 9
Claim 1
Independent Claim
40 words
A protein comprising the following sequence: ##STR2## where X is an amino acid residue selected from the group consisting of A, R, N, D, C, Q, E, G, H, I, L, K, M, F, P, S, T, V and Y.
Claim 2
Dependent Claim
40 words
A protein comprising the following sequence: ##STR2## where X is an amino acid residue selected from the group consisting of A, R, N, D, C, Q, E, G, H, I, L, K, M, F, P, S, T, V and Y.
Claim 3
Dependent Claim
19 words
The protein of claim 1 wherein the C-terminus of said sequence is attached to a phenylalanine synthesis pathway enzyme.
Claim 4
Dependent Claim
21 words
The protein of claim 1 wherein X is R, and the C-terminus of said sequence is attached to a G residue.
Claim 5
Dependent Claim
22 words
The protein of claim 1 wherein the C-terminus of said sequence is attached to the lacZα peptide encoded by portion of pUC19.
Claim 6
Dependent Claim
22 words
The protein of claim 1 wherein X is E and the C-terminus of said sequence is attached to the following sequence: EMFYLDIQANLESAEMQKALKELGEITRSMKVLGCYPSENVVPVDPT.
Claim 7
Dependent Claim
8 words
A protein having the following C-terminal sequence: ##STR3##
Claim 8
Dependent Claim
8 words
A protein having the following C-terminal sequence: ##STR3##
Claim 9
Dependent Claim
22 words
The protein of claim 1 or claim 6 wherein the N-terminal residue of said sequence is the N-terminal residue of said protein.
References Cited (Backward Citations)
AU7272781A
Cited
USPTO Annuity & Maintenance Windows
| Annuity Stage | Window Opens | Payment Deadline | Surcharge Period Until | Estimated Fee | Status |
|---|---|---|---|---|---|
| 3.5 Years (Year 4) | 1991-06-28 | 1991-12-28 | 1992-06-28 | $2000.00 | Window Closed / Lapsed |
| 7.5 Years (Year 8) | 1995-06-28 | 1995-12-28 | 1996-06-28 | $3760.00 | Window Closed / Lapsed |
| 11.5 Years (Year 12) | 1999-06-28 | 1999-12-28 | 2000-06-28 | $7700.00 | Window Closed / Lapsed |